PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G091400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 410aa    MW: 44356.4 Da    PI: 5.7588
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G091400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.8e-1870115147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +g+W++eEd  l ++v+++G+++W++Iar ++ gR++k+c++rw + 
  Aqcoe1G091400.1.p  70 KGPWSPEEDNVLSRLVAKFGPRNWSLIARGIP-GRSGKSCRLRWCNQ 115
                        79******************************.***********985 PP

2Myb_DNA-binding54.13.6e-17122166147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r+++T+eEd ++v a++ +G++ W+  ar ++ gRt++ +k++w++ 
  Aqcoe1G091400.1.p 122 RKPFTEEEDRIIVAAHAIHGNK-WAVLARLLP-GRTDNAIKNHWNST 166
                        789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.53965120IPR017930Myb domain
SuperFamilySSF466891.24E-3068163IPR009057Homeodomain-like
SMARTSM007177.2E-1669118IPR001005SANT/Myb domain
PfamPF002491.8E-1770115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2671123IPR009057Homeodomain-like
CDDcd001673.08E-1572114No hitNo description
PROSITE profilePS5129421.434121171IPR017930Myb domain
SMARTSM007172.5E-16121169IPR001005SANT/Myb domain
PfamPF002493.1E-14122166IPR001005SANT/Myb domain
CDDcd001672.61E-12124167No hitNo description
Gene3DG3DSA:1.10.10.604.8E-23124170IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MEREMKELKE QIDVFLAVNN INGGGVGART SGDSTTTVTV SEGNVIGEGG DNNENDLNNS  60
AGNGSDDRVK GPWSPEEDNV LSRLVAKFGP RNWSLIARGI PGRSGKSCRL RWCNQLDPGV  120
KRKPFTEEED RIIVAAHAIH GNKWAVLARL LPGRTDNAIK NHWNSTLRRR RIDFNKFRAA  180
SGEMMEDISH DKTKASSEDT LSCGDVNSFK SLEGKDVNSL DIISSQYDDR AQSNEDYCTN  240
KTNEPPTLFR PAARVSAFSI YNPPNGSTNA AQVSSAVPSN EPLIQTTPKP DFSICRLFEG  300
VCDEPQVPAR CGHGCCDNKG VVMARNSLLG AEFVEYEELP PFSSHELAAI ATDLSKIAWL  360
KSGLENSNTT VIDNAGRRGV PPGVCVGVGK TDAMSSQMSS QPFVLPAKS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C6e-42691703104C-Myb DNA-Binding Domain
1msf_C6e-42691703104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256736.11e-161PREDICTED: uncharacterized protein LOC104597048 isoform X1
TrEMBLA0A151RT461e-144A0A151RT46_CAJCA; Transcription factor MYB44
STRINGVIT_08s0007g01540.t011e-143(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-98myb domain protein 109